General Information

  • ID:  hor000824
  • Uniprot ID:  Q299B0
  • Protein name:  Corazonin precursor-related peptide
  • Gene name:  Crz
  • Organism:  Drosophila pseudoobscura pseudoobscura (Fruit fly)
  • Family:  Corazonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Drosophila pseudoobscura (species), pseudoobscura subgroup, obscura group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0071858 corazonin receptor binding
  • GO BP:  GO:0006117 acetaldehyde metabolic process; GO:0007218 neuropeptide signaling pathway; GO:0007619 courtship behavior; GO:0045823 positive regulation of heart contraction; GO:0048149 behavioral response to ethanol; GO:0071361 cellular response to ethanol
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  ALTPPSLLSHGHFNRASDLGFSDLYDVQDWSSE
  • Length:  33(35-67)
  • Propeptide:  MMRLLLLPLFLFTLSMACMGQTFQYSRGWTNGKRALTPPSLLSHGHFNRASDLGFSDLYDVQDWSSERRLERCLAQLQRSLLSRVYGSVVDFNANRPEPDSSDSGSSRNRANNNNENVLYPTPIQNRHHSSNELLEEISAAVAGSGPTGAGSGEPSVFGKH
  • Signal peptide:  MMRLLLLPLFLFTLSMACMG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be involved in the physiological regulation of the heart beat
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q299B0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000824_AF2.pdbhor000824_ESM.pdb

Physical Information

Mass: 423389 Formula: C163H237N43O54
Absent amino acids: CIKM Common amino acids: S
pI: 4.19 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 11
Hydrophobicity: -44.55 Boman Index: -5879
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 73.94
Instability Index: 3976.97 Extinction Coefficient cystines: 6990
Absorbance 280nm: 218.44

Literature

  • PubMed ID:  NA
  • Title:  NA